Lineage for d1ylqa1 (1ylq A:1-90)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740273Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (3 proteins)
    insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold
  6. 740278Protein Putative nucleotidyltransferase AF0614 [143232] (1 species)
  7. 740279Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143233] (1 PDB entry)
  8. 740280Domain d1ylqa1: 1ylq A:1-90 [123671]
    complexed with so4

Details for d1ylqa1

PDB Entry: 1ylq (more details), 2.02 Å

PDB Description: Crystal structure of putative nucleotidyltransferase
PDB Compounds: (A:) putative nucleotidyltransferase, hypothetical protein AF0614

SCOP Domain Sequences for d1ylqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylqa1 d.218.1.5 (A:1-90) Putative nucleotidyltransferase AF0614 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgkitkk
ffdspfefhiltkkewkmskrfirkyrrld

SCOP Domain Coordinates for d1ylqa1:

Click to download the PDB-style file with coordinates for d1ylqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ylqa1: