![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.5: Catalytic subunit of bi-partite nucleotidyltransferase [102932] (4 proteins) insert X in the core is an alpha-helix; minimal nucleotidyltransferase fold automatically mapped to Pfam PF01909 |
![]() | Protein Putative nucleotidyltransferase AF0614 [143232] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [143233] (1 PDB entry) Uniprot O29641 1-90 |
![]() | Domain d1ylqa1: 1ylq A:1-90 [123671] Other proteins in same PDB: d1ylqa2, d1ylqb2, d1ylqb3 complexed with so4 |
PDB Entry: 1ylq (more details), 2.02 Å
SCOPe Domain Sequences for d1ylqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylqa1 d.218.1.5 (A:1-90) Putative nucleotidyltransferase AF0614 {Archaeoglobus fulgidus [TaxId: 2234]} mkeikeitkkdvqdaeiylygsvvegdysiglsdidvaivsdvfedrnrkleffgkitkk ffdspfefhiltkkewkmskrfirkyrrld
Timeline for d1ylqa1: