Lineage for d1ylof1 (1ylo F:67-147)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671859Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 671860Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 671861Protein Aminopeptidase YpdE [141389] (1 species)
  7. 671862Species Shigella flexneri [TaxId:623] [141390] (1 PDB entry)
    hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt)
  8. 671868Domain d1ylof1: 1ylo F:67-147 [123669]
    Other proteins in same PDB: d1yloa2, d1ylob2, d1yloc2, d1ylod2, d1yloe2, d1ylof2
    automatically matched to 1YLO A:67-147
    complexed with zn

Details for d1ylof1

PDB Entry: 1ylo (more details), 2.15 Å

PDB Description: crystal structure of protein of unknown function (possible aminopeptidase) s2589 from shigella flexneri 2a str. 2457t
PDB Compounds: (F:) hypothetical protein SF2450

SCOP Domain Sequences for d1ylof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylof1 b.49.3.1 (F:67-147) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]}
gfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgndvsamrvd
igartydevmqagirpgdrvt

SCOP Domain Coordinates for d1ylof1:

Click to download the PDB-style file with coordinates for d1ylof1.
(The format of our PDB-style files is described here.)

Timeline for d1ylof1: