![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) ![]() |
![]() | Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
![]() | Protein Aminopeptidase YpdE [141389] (1 species) |
![]() | Species Shigella flexneri [TaxId:623] [141390] (1 PDB entry) hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt) |
![]() | Domain d1ylof1: 1ylo F:67-147 [123669] Other proteins in same PDB: d1yloa2, d1ylob2, d1yloc2, d1ylod2, d1yloe2, d1ylof2 automatically matched to 1YLO A:67-147 complexed with zn |
PDB Entry: 1ylo (more details), 2.15 Å
SCOP Domain Sequences for d1ylof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylof1 b.49.3.1 (F:67-147) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} gfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgndvsamrvd igartydevmqagirpgdrvt
Timeline for d1ylof1: