Lineage for d1ylof1 (1ylo F:67-147)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. Protein Aminopeptidase YpdE [141389] (1 species)
  7. Species Shigella flexneri [TaxId:623] [141390] (1 PDB entry)
    Uniprot Q83K87 67-147
    hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt)
  8. Domain d1ylof1: 1ylo F:67-147 [123669]
    Other proteins in same PDB: d1yloa2, d1yloa3, d1ylob2, d1ylob3, d1yloc2, d1yloc3, d1ylod2, d1ylod3, d1yloe2, d1yloe3, d1ylof2, d1ylof3
    automated match to d1yloa1
    complexed with zn

Details for d1ylof1

PDB Entry: 1ylo (more details), 2.15 Å

PDB Description: crystal structure of protein of unknown function (possible aminopeptidase) s2589 from shigella flexneri 2a str. 2457t
PDB Compounds: (F:) hypothetical protein SF2450

SCOPe Domain Sequences for d1ylof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylof1 b.49.3.1 (F:67-147) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]}
gfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgndvsamrvd
igartydevmqagirpgdrvt

SCOPe Domain Coordinates for d1ylof1 are not available.

Timeline for d1ylof1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylof2, d1ylof3
View in 3D
Domains from other chains:
(mouse over for more information)
d1yloa1, d1yloa2, d1yloa3, d1ylob1, d1ylob2, d1ylob3, d1yloc1, d1yloc2, d1yloc3, d1ylod1, d1ylod2, d1ylod3, d1yloe1, d1yloe2, d1yloe3