Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Aminopeptidase YpdE [142520] (1 species) |
Species Shigella flexneri [TaxId:623] [142521] (1 PDB entry) Uniprot Q83K87 1-66,148-345 hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt) |
Domain d1ylod2: 1ylo D:0-66,D:148-345 [123666] Other proteins in same PDB: d1yloa1, d1ylob1, d1yloc1, d1ylod1, d1yloe1, d1ylof1 automated match to d1yloa2 complexed with zn |
PDB Entry: 1ylo (more details), 2.15 Å
SCOPe Domain Sequences for d1ylod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylod2 c.56.5.4 (D:0-66,D:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} amdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmi cahmdevXfdttfqvlphqrvmgkafddrlscyllvtllrelhdaelpaevwlvasssee vglrggqtatravspdvaivldtacwaknfdygaanhrqigngpmlvlsdksliappklt awietvaaeigvplqadmfsnggtdggavhltgtgvptlvmgpatrhghcaasiadcrdi lqmeqllsaliqrltretvvqltdfr
Timeline for d1ylod2: