Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) |
Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
Protein Aminopeptidase YpdE [141389] (1 species) |
Species Shigella flexneri [TaxId:623] [141390] (1 PDB entry) Uniprot Q83K87 67-147 hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt) |
Domain d1ylod1: 1ylo D:67-147 [123665] Other proteins in same PDB: d1yloa2, d1yloa3, d1ylob2, d1ylob3, d1yloc2, d1yloc3, d1ylod2, d1ylod3, d1yloe2, d1yloe3, d1ylof2, d1ylof3 automated match to d1yloa1 complexed with zn |
PDB Entry: 1ylo (more details), 2.15 Å
SCOPe Domain Sequences for d1ylod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylod1 b.49.3.1 (D:67-147) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} gfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgndvsamrvd igartydevmqagirpgdrvt
Timeline for d1ylod1: