![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins) |
![]() | Protein Aminopeptidase YpdE [142520] (1 species) |
![]() | Species Shigella flexneri [TaxId:623] [142521] (1 PDB entry) hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt) |
![]() | Domain d1yloc2: 1ylo C:1-66,C:148-345 [123664] Other proteins in same PDB: d1yloa1, d1ylob1, d1yloc1, d1ylod1, d1yloe1, d1ylof1 automatically matched to 1YLO A:1-66,A:148-345 complexed with zn |
PDB Entry: 1ylo (more details), 2.15 Å
SCOP Domain Sequences for d1yloc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yloc2 c.56.5.4 (C:1-66,C:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} mdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmic ahmdevXfdttfqvlphqrvmgkafddrlscyllvtllrelhdaelpaevwlvassseev glrggqtatravspdvaivldtacwaknfdygaanhrqigngpmlvlsdksliappklta wietvaaeigvplqadmfsnggtdggavhltgtgvptlvmgpatrhghcaasiadcrdil qmeqllsaliqrltretvvqltdfr
Timeline for d1yloc2: