Lineage for d1yloc2 (1ylo C:1-66,C:148-345)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889724Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2889763Protein Aminopeptidase YpdE [142520] (1 species)
  7. 2889764Species Shigella flexneri [TaxId:623] [142521] (1 PDB entry)
    Uniprot Q83K87 1-66,148-345
    hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt)
  8. 2889767Domain d1yloc2: 1ylo C:1-66,C:148-345 [123664]
    Other proteins in same PDB: d1yloa1, d1yloa3, d1ylob1, d1ylob3, d1yloc1, d1yloc3, d1ylod1, d1ylod3, d1yloe1, d1yloe3, d1ylof1, d1ylof3
    automated match to d1yloa2
    complexed with zn

Details for d1yloc2

PDB Entry: 1ylo (more details), 2.15 Å

PDB Description: crystal structure of protein of unknown function (possible aminopeptidase) s2589 from shigella flexneri 2a str. 2457t
PDB Compounds: (C:) hypothetical protein SF2450

SCOPe Domain Sequences for d1yloc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yloc2 c.56.5.4 (C:1-66,C:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]}
mdlsllkalseadaiasseqevrqilleeaarlqkevrfdglgsvlirlnestgpkvmic
ahmdevXfdttfqvlphqrvmgkafddrlscyllvtllrelhdaelpaevwlvassseev
glrggqtatravspdvaivldtacwaknfdygaanhrqigngpmlvlsdksliappklta
wietvaaeigvplqadmfsnggtdggavhltgtgvptlvmgpatrhghcaasiadcrdil
qmeqllsaliqrltretvvqltdfr

SCOPe Domain Coordinates for d1yloc2:

Click to download the PDB-style file with coordinates for d1yloc2.
(The format of our PDB-style files is described here.)

Timeline for d1yloc2: