SCOP 1.75: Domain d1yloc1: 1ylo C:67-147

Lineage for d1yloc1 (1ylo C:67-147)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)

6. Protein Aminopeptidase YpdE [141389] (1 species)

7. Species Shigella flexneri [TaxId:623] [141390] (1 PDB entry)
   Uniprot Q83K87 67-147
   hypothetical protein SF2450 (PDB)/SF2449.1 (UniProt)

8. Domain d1yloc1: 1ylo C:67-147 [123663]
   Other proteins in same PDB: d1yloa2, d1ylob2, d1yloc2, d1ylod2, d1yloe2, d1ylof2
   automatically matched to 1YLO A:67-147
   complexed with zn

Details for d1yloc1

PDB Entry: 1ylo, 2.15 Å

PDB Description: crystal structure of protein of unknown function (possible aminopeptidase) s2589 from shigella flexneri 2a str. 2457t

PDB Compounds: (C:) hypothetical protein SF2450

SCOP Domain Sequences for d1yloc1:

Sequence; same for both SEQRES and ATOM records:

>d1yloc1 b.49.3.1 (C:67-147) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]}
gfmvrsisregaidvlpvgnvrmaarqlqpvrittreeckipglldgdrqgndvsamrvd
igartydevmqagirpgdrvt

Timeline for d1yloc1:

• d1yloc1 first appeared in SCOP 1.73
  
• d1yloc1 appears in SCOPe 2.01
  
• d1yloc1 appears in the current release, SCOPe 2.08