Class b: All beta proteins [48724] (174 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.2: PilZ domain-like [141371] (2 families) |
Family b.45.2.2: PilZ domain-associated domain [141377] (2 proteins) this domain preceeds PilZ domain in some proteins automatically mapped to Pfam PF12945 |
Protein Hypothetical protein VCA0042, N-terminal domain [141378] (2 species) |
Species Vibrio cholerae [TaxId:666] [141379] (1 PDB entry) Uniprot Q9KNC3 23-137 |
Domain d1ylna2: 1yln A:23-137 [123658] Other proteins in same PDB: d1ylna1 contains modified serine residue; phosphoserine |
PDB Entry: 1yln (more details), 2.2 Å
SCOPe Domain Sequences for d1ylna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylna2 b.45.2.2 (A:23-137) Hypothetical protein VCA0042, N-terminal domain {Vibrio cholerae [TaxId: 666]} tvstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlq yffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrk
Timeline for d1ylna2: