SCOPe 2.03: Domain d1ylna2: 1yln A:23-137

Lineage for d1ylna2 (1yln A:23-137)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.2: PilZ domain-associated domain [141377] (2 proteins)
   this domain preceeds PilZ domain in some proteins
   automatically mapped to Pfam PF12945

6. Protein Hypothetical protein VCA0042, N-terminal domain [141378] (2 species)

7. Species Vibrio cholerae [TaxId:666] [141379] (1 PDB entry)
   Uniprot Q9KNC3 23-137

8. Domain d1ylna2: 1yln A:23-137 [123658]
   Other proteins in same PDB: d1ylna1
   contains modified serine residue; phosphoserine

Details for d1ylna2

PDB Entry: 1yln, 2.2 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function VCA0042 from Vibrio cholerae O1

PDB Compounds: (A:) hypothetical protein vca0042

SCOPe Domain Sequences for d1ylna2:

Sequence; same for both SEQRES and ATOM records:

>d1ylna2 b.45.2.2 (A:23-137) Hypothetical protein VCA0042, N-terminal domain {Vibrio cholerae [TaxId: 666]}
tvstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlq
yffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrk

Timeline for d1ylna2:

• d1ylna2 first appeared in SCOP 1.73
  
• d1ylna2 appears in SCOPe 2.02
  
• d1ylna2 appears in SCOPe 2.04
  
• d1ylna2 appears in the current release, SCOPe 2.08