Lineage for d1ylna2 (1yln A:23-137)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. Superfamily b.45.2: PilZ domain-like [141371] (2 families) (S)
  5. Family b.45.2.2: PilZ domain-associated domain [141377] (2 proteins)
    this domain preceeds PilZ domain in some proteins
    automatically mapped to Pfam PF12945
  6. Protein Hypothetical protein VCA0042, N-terminal domain [141378] (2 species)
  7. Species Vibrio cholerae [TaxId:666] [141379] (1 PDB entry)
    Uniprot Q9KNC3 23-137
  8. Domain d1ylna2: 1yln A:23-137 [123658]
    Other proteins in same PDB: d1ylna1
    contains modified serine residue; phosphoserine

Details for d1ylna2

PDB Entry: 1yln (more details), 2.2 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function VCA0042 from Vibrio cholerae O1
PDB Compounds: (A:) hypothetical protein vca0042

SCOPe Domain Sequences for d1ylna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylna2 b.45.2.2 (A:23-137) Hypothetical protein VCA0042, N-terminal domain {Vibrio cholerae [TaxId: 666]}
tvstinstdalamvehsseltlsittpvgtkfvcrtpfigthtdkfllvempkisaddlq
yffqegfwmniraisprgegalihfrsqlmhilqepvpmaflsipntmqvsqlrk

SCOPe Domain Coordinates for d1ylna2 are not available.

Timeline for d1ylna2:

Domains from same chain:
(mouse over for more information)
d1ylna1