SCOPe 2.05: Domain d1ylna1: 1yln A:138-248

Lineage for d1ylna1 (1yln A:138-248)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.1: PilZ domain [141372] (3 proteins)
   Pfam PF07238

6. Protein Hypothetical protein VCA0042, C-terminal domain [141373] (2 species)

7. Species Vibrio cholerae [TaxId:666] [141374] (1 PDB entry)
   Uniprot Q9KNC3 138-248

8. Domain d1ylna1: 1yln A:138-248 [123657]
   Other proteins in same PDB: d1ylna2

Details for d1ylna1

PDB Entry: 1yln, 2.2 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function VCA0042 from Vibrio cholerae O1

PDB Compounds: (A:) hypothetical protein vca0042

SCOPe Domain Sequences for d1ylna1:

Sequence; same for both SEQRES and ATOM records:

>d1ylna1 b.45.2.1 (A:138-248) Hypothetical protein VCA0042, C-terminal domain {Vibrio cholerae [TaxId: 666]}
eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk
tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltlna

Timeline for d1ylna1:

• d1ylna1 first appeared in SCOP 1.73
  
• d1ylna1 appears in SCOPe 2.04
  
• d1ylna1 appears in SCOPe 2.06
  
• d1ylna1 appears in the current release, SCOPe 2.08