SCOP 1.73: Domain d1ylna1: 1yln A:138-248

Lineage for d1ylna1 (1yln A:138-248)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.45: Split barrel-like [50474] (2 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.2: PilZ domain-like [141371] (2 families)

5. Family b.45.2.1: PilZ domain [141372] (2 proteins)
   Pfam PF07238

6. Protein Hypothetical protein VCA0042, C-terminal domain [141373] (1 species)

7. Species Vibrio cholerae [TaxId:666] [141374] (1 PDB entry)

8. Domain d1ylna1: 1yln A:138-248 [123657]
   Other proteins in same PDB: d1ylna2
   complexed with ose

Details for d1ylna1

PDB Entry: 1yln, 2.2 Å

PDB Description: The Crystal Structure of the Protein of Unknown Function VCA0042 from Vibrio cholerae O1

PDB Compounds: (A:) hypothetical protein vca0042

SCOP Domain Sequences for d1ylna1:

Sequence; same for both SEQRES and ATOM records:

>d1ylna1 b.45.2.1 (A:138-248) Hypothetical protein VCA0042, C-terminal domain {Vibrio cholerae [TaxId: 666]}
eprfelnlagkvlfdehrgdcelrdlsrsgcrfitpplgktyqvgdlvaleifsdlrgtk
tfppltgkicnlqrslhharyglefneegrnnaknllaqlkfngtkltlna

Timeline for d1ylna1:

• d1ylna1 is new in SCOP 1.73
  
• d1ylna1 appears in SCOP 1.75
  
• d1ylna1 appears in the current release, SCOPe 2.08