SCOP 1.73: Domain d1ylld1: 1yll D:3-196

Lineage for d1ylld1 (1yll D:3-196)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.17: PA5104-like [141609] (1 protein)
   Pfam PF05962; DUF886; duplication: consists of two germin-like domains; overall structural similarity to the YlbA-like family (scop_fa 101979) except a deletion in the interdomain linker region

6. Protein Hypothetical protein PA5104 [141610] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141611] (1 PDB entry)

8. Domain d1ylld1: 1yll D:3-196 [123656]
   automatically matched to 1YLL A:2-196

Details for d1ylld1

PDB Entry: 1yll, 1.64 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function PA5104 from Pseudomonas aeruginosa PAO1

PDB Compounds: (D:) conserved hypothetical protein

SCOP Domain Sequences for d1ylld1:

Sequence; same for both SEQRES and ATOM records:

>d1ylld1 b.82.1.17 (D:3-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
elrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqri
isvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarl
qwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlta
hepawvcaveldsl

Timeline for d1ylld1:

• d1ylld1 is new in SCOP 1.73
  
• d1ylld1 appears in SCOP 1.75
  
• d1ylld1 appears in the current release, SCOPe 2.08, called d1ylld2