SCOPe 2.01: Domain d1ylib_: 1yli B:

Lineage for d1ylib_ (1yli B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Putative acyl-coa thioester hydrolase HI0827 [102903] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [102904] (1 PDB entry)

8. Domain d1ylib_: 1yli B: [123652]
   automated match to d1nngb_
   complexed with ca, coa, gol

Details for d1ylib_

PDB Entry: 1yli, 1.95 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase

PDB Compounds: (B:) Putative acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d1ylib_:

Sequence; same for both SEQRES and ATOM records:

>d1ylib_ d.38.1.1 (B:) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]}
ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
vdnngrsrtiprennqelekalaliseq

Timeline for d1ylib_:

• d1ylib_ first appeared in SCOP 1.73, called d1ylib1
  
• d1ylib_ was called d1ylib1 in SCOP 1.75
  
• d1ylib_ appears in SCOPe 2.02
  
• d1ylib_ appears in the current release, SCOPe 2.08