Lineage for d1ylfc1 (1ylf C:6-142)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635827Family a.4.5.55: Transcriptional regulator Rrf2 [109699] (2 proteins)
    Pfam PF02082
  6. 635828Protein Hypothetical protein BC1842 [140275] (1 species)
  7. 635829Species Bacillus cereus [TaxId:1396] [140276] (1 PDB entry)
  8. 635832Domain d1ylfc1: 1ylf C:6-142 [123650]
    automatically matched to 1YLF A:5-142
    complexed with cl

Details for d1ylfc1

PDB Entry: 1ylf (more details), 2.5 Å

PDB Description: x-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.
PDB Compounds: (C:) RRF2 family protein

SCOP Domain Sequences for d1ylfc1:

Sequence, based on SEQRES records: (download)

>d1ylfc1 a.4.5.55 (C:6-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]}
issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg
agllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsame
evlrnitmgqlfetlqe

Sequence, based on observed residues (ATOM records): (download)

>d1ylfc1 a.4.5.55 (C:6-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]}
issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg
agllkdlheitlldvyhavnvganiqavleiiliqaqsameevlrnitmgqlfetlqe

SCOP Domain Coordinates for d1ylfc1:

Click to download the PDB-style file with coordinates for d1ylfc1.
(The format of our PDB-style files is described here.)

Timeline for d1ylfc1: