SCOP 1.73: Domain d1ylfc1: 1ylf C:6-142

Lineage for d1ylfc1 (1ylf C:6-142)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.55: Transcriptional regulator Rrf2 [109699] (2 proteins)
   Pfam PF02082

6. Protein Hypothetical protein BC1842 [140275] (1 species)

7. Species Bacillus cereus [TaxId:1396] [140276] (1 PDB entry)

8. Domain d1ylfc1: 1ylf C:6-142 [123650]
   automatically matched to 1YLF A:5-142
   complexed with cl

Details for d1ylfc1

PDB Entry: 1ylf, 2.5 Å

PDB Description: x-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.

PDB Compounds: (C:) RRF2 family protein

SCOP Domain Sequences for d1ylfc1:

Sequence, based on SEQRES records:

>d1ylfc1 a.4.5.55 (C:6-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]}
issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg
agllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsame
evlrnitmgqlfetlqe

Sequence, based on observed residues (ATOM records):

>d1ylfc1 a.4.5.55 (C:6-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]}
issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg
agllkdlheitlldvyhavnvganiqavleiiliqaqsameevlrnitmgqlfetlqe

Timeline for d1ylfc1:

• d1ylfc1 is new in SCOP 1.73
  
• d1ylfc1 appears in SCOP 1.75
  
• d1ylfc1 appears in the current release, SCOPe 2.08, called d1ylfc_