![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [186878] (2 PDB entries) |
![]() | Domain d1ylfc_: 1ylf C: [123650] Other proteins in same PDB: d1ylfa1 automated match to d1xd7a_ complexed with cl |
PDB Entry: 1ylf (more details), 2.5 Å
SCOPe Domain Sequences for d1ylfc_:
Sequence, based on SEQRES records: (download)
>d1ylfc_ a.4.5.0 (C:) automated matches {Bacillus cereus [TaxId: 226900]} issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg agllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsame evlrnitmgqlfetlqek
>d1ylfc_ a.4.5.0 (C:) automated matches {Bacillus cereus [TaxId: 226900]} issrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpgg agllkdlheitlldvyhavnvganiqavleiiliqaqsameevlrnitmgqlfetlqek
Timeline for d1ylfc_: