SCOPe 2.08: Domain d1ylfa1: 1ylf A:5-142

Lineage for d1ylfa1 (1ylf A:5-142)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.55: Transcriptional regulator Rrf2 [109699] (2 proteins)
   Pfam PF02082

6. Protein Hypothetical protein BC1842 [140275] (1 species)

7. Species Bacillus cereus [TaxId:1396] [140276] (1 PDB entry)
   Uniprot Q81EX1 5-142

8. Domain d1ylfa1: 1ylf A:5-142 [123648]
   Other proteins in same PDB: d1ylfb_, d1ylfc_
   complexed with cl

Details for d1ylfa1

PDB Entry: 1ylf, 2.5 Å

PDB Description: x-ray crystal structure of bc1842 protein from bacillus cereus, a member of the rrf2 family of putative transcription regulators.

PDB Compounds: (A:) RRF2 family protein

SCOPe Domain Sequences for d1ylfa1:

Sequence, based on SEQRES records:

>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]}
kissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnrgpg
gagllkdlheitlldvyhavnvveedklfhiheqpnpdcpiganiqavleiiliqaqsam
eevlrnitmgqlfetlqe

Sequence, based on observed residues (ATOM records):

>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]}
kissrfsiavhilsilknnpsslctsdymaesvntnpvvirkimsylkqagfvyvnggag
llkdlheitlldvyhavnviganiqavleiiliqaqsameevlrnitmgqlfetlqe

Timeline for d1ylfa1:

• d1ylfa1 first appeared in SCOP 1.73
  
• d1ylfa1 appears in SCOPe 2.07