Lineage for d1ylea1 (1yle A:1-338)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533739Family d.108.1.8: AstA-like [143717] (1 protein)
    Pfam PF04958; contains extra C-terminal domain, similar to the double psi beta-barrel fold (50684) with missing one strand and untangled psi-loops
  6. 2533740Protein Arginine N-succinyltransferase, alpha chain, AstA [143718] (1 species)
  7. 2533741Species Pseudomonas aeruginosa [TaxId:287] [143719] (1 PDB entry)
    Uniprot P80357 1-338
  8. 2533742Domain d1ylea1: 1yle A:1-338 [123647]
    Other proteins in same PDB: d1ylea2, d1ylea3
    complexed with ca, fmt

Details for d1ylea1

PDB Entry: 1yle (more details), 1.7 Å

PDB Description: The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa.
PDB Compounds: (A:) Arginine N-succinyltransferase, alpha chain

SCOPe Domain Sequences for d1ylea1:

Sequence, based on SEQRES records: (download)

>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]}
mlvmrpaqaadlpqvqrlaadspvgvtslpddaerlrdkilaseasfaaevsyngeesyf
fvledsasgelvgcsaivasagfsepfysfrnetfvhasrslsihnkihvlslchdltgn
slltsfyvqrdlvqsvyaelnsrgrllfmashperfadavvveivgysdeqgespfwnav
grnffdlnyieaeklsglksrtflaelmphypiyvpllpdaaqesmgqvhpraqitfdil
mregfetdnyidifdggptlhartsgirsiaqsrvvpvkigeapksgrpylvtngqlqdf
ravvldldwapgkpvalsveaaealgvgegasvrlvav

Sequence, based on observed residues (ATOM records): (download)

>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]}
mlvmrpaqaadlpqvqrlaadspvgvtslpddaerlrdkilaseasfaaevsyngeesyf
fvledsasgelvgcsaivasagfsepfysfrnetfvhasrslsihnkihvlslchdltgn
slltsfyvqrdlvqsvyaelnsrgrllfmashperfadavvveivgysdeqgespfwnav
grnffdlnyieaeklsglkhypiyvpllpdaaqesmgqvhpraqitfdilmregfetdny
idifdggptlhartsgirsiaqsrvvpvkigeksgrpylvtngqlqdfravvldldwapg
kpvalsveaaealgvgegasvrlvav

SCOPe Domain Coordinates for d1ylea1:

Click to download the PDB-style file with coordinates for d1ylea1.
(The format of our PDB-style files is described here.)

Timeline for d1ylea1: