Lineage for d1ylda_ (1yld A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065963Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2065971Domain d1ylda_: 1yld A: [123646]
    Other proteins in same PDB: d1yldb1
    automated match to d1anb__
    complexed with ca, so4; mutant

Details for d1ylda_

PDB Entry: 1yld (more details), 1.7 Å

PDB Description: trypsin/bpti complex mutant
PDB Compounds: (A:) trypsin II

SCOPe Domain Sequences for d1ylda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylda_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1ylda_:

Click to download the PDB-style file with coordinates for d1ylda_.
(The format of our PDB-style files is described here.)

Timeline for d1ylda_: