SCOPe 2.01: Domain d1ylda_: 1yld A:

Lineage for d1ylda_ (1yld A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)

8. Domain d1ylda_: 1yld A: [123646]
   Other proteins in same PDB: d1yldb1
   automated match to d1anb__
   complexed with ca, so4; mutant

Details for d1ylda_

PDB Entry: 1yld, 1.7 Å

PDB Description: trypsin/bpti complex mutant

PDB Compounds: (A:) trypsin II

SCOPe Domain Sequences for d1ylda_:

Sequence; same for both SEQRES and ATOM records:

>d1ylda_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ylda_:

• d1ylda_ first appeared in SCOP 1.73, called d1ylda1
  
• d1ylda_ was called d1ylda1 in SCOP 1.75
  
• d1ylda_ appears in SCOPe 2.02
  
• d1ylda_ appears in the current release, SCOPe 2.08