Lineage for d1ylda1 (1yld A:16-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 671094Protein Trypsin(ogen) [50515] (9 species)
  7. 671445Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries)
  8. 671450Domain d1ylda1: 1yld A:16-245 [123646]
    automatically matched to d3tgje_
    complexed with aba, ca, so4; mutant

Details for d1ylda1

PDB Entry: 1yld (more details), 1.7 Å

PDB Description: trypsin/bpti complex mutant
PDB Compounds: (A:) trypsin II

SCOP Domain Sequences for d1ylda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylda1 b.47.1.2 (A:16-245) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1ylda1:

Click to download the PDB-style file with coordinates for d1ylda1.
(The format of our PDB-style files is described here.)

Timeline for d1ylda1: