SCOPe 2.08: Domain d1ylca_: 1ylc A:

Lineage for d1ylca_ (1ylc A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d1ylca_: 1ylc A: [123645]
   Other proteins in same PDB: d1ylcb1
   automated match to d1anb__
   complexed with ca, so4; mutant

Details for d1ylca_

PDB Entry: 1ylc, 1.7 Å

PDB Description: trypsin/bpti complex mutant

PDB Compounds: (A:) trypsin II

SCOPe Domain Sequences for d1ylca_:

Sequence; same for both SEQRES and ATOM records:

>d1ylca_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1ylca_:

• d1ylca_ first appeared in SCOP 1.73, called d1ylca1
  
• d1ylca_ appears in SCOPe 2.07