Lineage for d1ylca_ (1ylc A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2388843Protein Trypsin(ogen) [50515] (9 species)
  7. 2389358Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2389378Domain d1ylca_: 1ylc A: [123645]
    Other proteins in same PDB: d1ylcb1
    automated match to d1anb__
    complexed with ca, so4; mutant

Details for d1ylca_

PDB Entry: 1ylc (more details), 1.7 Å

PDB Description: trypsin/bpti complex mutant
PDB Compounds: (A:) trypsin II

SCOPe Domain Sequences for d1ylca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylca_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1ylca_:

Click to download the PDB-style file with coordinates for d1ylca_.
(The format of our PDB-style files is described here.)

Timeline for d1ylca_: