SCOP 1.75: Domain d1ylab2: 1yla B:1-156

Lineage for d1ylab2 (1yla B:1-156)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Human (Homo sapiens) [TaxId:9606] [143064] (3 PDB entries)
   Uniprot P61086 1-156

8. Domain d1ylab2: 1yla B:1-156 [123644]
   Other proteins in same PDB: d1ylaa1, d1ylab1
   automatically matched to 1YLA A:1-156

Details for d1ylab2

PDB Entry: 1yla, 2.4 Å

PDB Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d1ylab2:

Sequence; same for both SEQRES and ATOM records:

>d1ylab2 d.20.1.1 (B:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

Timeline for d1ylab2:

• d1ylab2 first appeared in SCOP 1.73
  
• d1ylab2 appears in SCOPe 2.01
  
• d1ylab2 appears in the current release, SCOPe 2.08