Lineage for d1ylab2 (1yla B:1-156)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720139Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 720143Species Human (Homo sapiens) [TaxId:9606] [143064] (2 PDB entries)
  8. 720145Domain d1ylab2: 1yla B:1-156 [123644]
    Other proteins in same PDB: d1ylaa1, d1ylab1
    automatically matched to 1YLA A:1-156

Details for d1ylab2

PDB Entry: 1yla (more details), 2.4 Å

PDB Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d1ylab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylab2 d.20.1.1 (B:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

SCOP Domain Coordinates for d1ylab2:

Click to download the PDB-style file with coordinates for d1ylab2.
(The format of our PDB-style files is described here.)

Timeline for d1ylab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylab1