Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species) ubc1 homologue; also contains the C-terminal UBA domain |
Species Human (Homo sapiens) [TaxId:9606] [143064] (2 PDB entries) |
Domain d1ylab2: 1yla B:1-156 [123644] Other proteins in same PDB: d1ylaa1, d1ylab1 automatically matched to 1YLA A:1-156 |
PDB Entry: 1yla (more details), 2.4 Å
SCOP Domain Sequences for d1ylab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylab2 d.20.1.1 (B:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]} maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa epddpqdavvanqykqnpemfkqtarlwahvyagap
Timeline for d1ylab2: