| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
| Family a.5.2.1: UBA domain [46935] (25 proteins) |
| Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140328] (6 PDB entries) Uniprot P61086 157-198 |
| Domain d1ylab1: 1yla B:157-199 [123643] Other proteins in same PDB: d1ylaa2, d1ylab2 automated match to d1ylaa1 |
PDB Entry: 1yla (more details), 2.4 Å
SCOPe Domain Sequences for d1ylab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylab1 a.5.2.1 (B:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatellls
Timeline for d1ylab1: