Lineage for d1ylab1 (1yla B:157-198)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636455Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 636456Species Human (Homo sapiens) [TaxId:9606] [140328] (2 PDB entries)
  8. 636458Domain d1ylab1: 1yla B:157-198 [123643]
    Other proteins in same PDB: d1ylaa2, d1ylab2
    automatically matched to 1YLA A:157-198

Details for d1ylab1

PDB Entry: 1yla (more details), 2.4 Å

PDB Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOP Domain Sequences for d1ylab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylab1 a.5.2.1 (B:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelll

SCOP Domain Coordinates for d1ylab1:

Click to download the PDB-style file with coordinates for d1ylab1.
(The format of our PDB-style files is described here.)

Timeline for d1ylab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ylab2