Lineage for d1ylaa1 (1yla A:157-198)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984758Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1984759Family a.5.2.1: UBA domain [46935] (25 protein domains)
  6. 1984840Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 1984841Species Human (Homo sapiens) [TaxId:9606] [140328] (7 PDB entries)
    Uniprot P61086 157-198
  8. 1984845Domain d1ylaa1: 1yla A:157-198 [123641]
    Other proteins in same PDB: d1ylaa2, d1ylaa3, d1ylab2, d1ylab3

Details for d1ylaa1

PDB Entry: 1yla (more details), 2.4 Å

PDB Description: Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d1ylaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylaa1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelll

SCOPe Domain Coordinates for d1ylaa1:

Click to download the PDB-style file with coordinates for d1ylaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ylaa1: