![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Dihydrodipicolinate reductase [55371] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [103104] (5 PDB entries) |
![]() | Domain d1yl7h2: 1yl7 H:106-214 [123640] Other proteins in same PDB: d1yl7a1, d1yl7b1, d1yl7c1, d1yl7d1, d1yl7e1, d1yl7f1, d1yl7g1, d1yl7h1 automatically matched to d1c3va2 complexed with mg, nai |
PDB Entry: 1yl7 (more details), 2.34 Å
SCOPe Domain Sequences for d1yl7h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl7h2 d.81.1.3 (H:106-214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr
Timeline for d1yl7h2: