![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Dihydrodipicolinate reductase [51821] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries) |
![]() | Domain d1yl7b1: 1yl7 B:2-105,B:215-245 [123627] Other proteins in same PDB: d1yl7a2, d1yl7b2, d1yl7c2, d1yl7d2, d1yl7e2, d1yl7f2, d1yl7g2, d1yl7h2 automatically matched to d1c3va1 complexed with mg, nai |
PDB Entry: 1yl7 (more details), 2.34 Å
SCOPe Domain Sequences for d1yl7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl7b1 c.2.1.3 (B:2-105,B:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} rvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmgn leflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrria erpgltvgleplldlh
Timeline for d1yl7b1: