Lineage for d1yl7a2 (1yl7 A:106-214)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962054Protein Dihydrodipicolinate reductase [55371] (3 species)
  7. 2962064Species Mycobacterium tuberculosis [TaxId:1773] [103104] (5 PDB entries)
  8. 2962069Domain d1yl7a2: 1yl7 A:106-214 [123626]
    Other proteins in same PDB: d1yl7a1, d1yl7a3, d1yl7b1, d1yl7b3, d1yl7c1, d1yl7c3, d1yl7d1, d1yl7d3, d1yl7e1, d1yl7e3, d1yl7f1, d1yl7f3, d1yl7g1, d1yl7g3, d1yl7h1, d1yl7h3
    automatically matched to d1c3va2
    complexed with mg, nai

Details for d1yl7a2

PDB Entry: 1yl7 (more details), 2.34 Å

PDB Description: the crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1yl7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl7a2 d.81.1.3 (A:106-214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat
stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr

SCOPe Domain Coordinates for d1yl7a2:

Click to download the PDB-style file with coordinates for d1yl7a2.
(The format of our PDB-style files is described here.)

Timeline for d1yl7a2: