Lineage for d1yl7a1 (1yl7 A:2-105,A:215-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2104932Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 2104942Species Mycobacterium tuberculosis [TaxId:1773] [102160] (5 PDB entries)
  8. 2104947Domain d1yl7a1: 1yl7 A:2-105,A:215-245 [123625]
    Other proteins in same PDB: d1yl7a2, d1yl7a3, d1yl7b2, d1yl7b3, d1yl7c2, d1yl7c3, d1yl7d2, d1yl7d3, d1yl7e2, d1yl7e3, d1yl7f2, d1yl7f3, d1yl7g2, d1yl7g3, d1yl7h2, d1yl7h3
    automatically matched to d1c3va1
    complexed with mg, nai

Details for d1yl7a1

PDB Entry: 1yl7 (more details), 2.34 Å

PDB Description: the crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1yl7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
rvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmgn
leflidngihavvgttgftaerfqqveswlvakpntsvliapnfXtsfvpgvllavrria
erpgltvgleplldlh

SCOPe Domain Coordinates for d1yl7a1:

Click to download the PDB-style file with coordinates for d1yl7a1.
(The format of our PDB-style files is described here.)

Timeline for d1yl7a1: