Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein Dihydrodipicolinate reductase [55371] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [103104] (5 PDB entries) |
Domain d1yl6a2: 1yl6 A:106-214 [123622] Other proteins in same PDB: d1yl6a1, d1yl6a3, d1yl6b1, d1yl6b3 automatically matched to d1c3va2 complexed with mg |
PDB Entry: 1yl6 (more details), 2.9 Å
SCOPe Domain Sequences for d1yl6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl6a2 d.81.1.3 (A:106-214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr
Timeline for d1yl6a2: