Lineage for d1yl6a2 (1yl6 A:106-214)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. Protein Dihydrodipicolinate reductase [55371] (3 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [103104] (5 PDB entries)
  8. Domain d1yl6a2: 1yl6 A:106-214 [123622]
    Other proteins in same PDB: d1yl6a1, d1yl6a3, d1yl6b1, d1yl6b3
    automatically matched to d1c3va2
    complexed with mg

Details for d1yl6a2

PDB Entry: 1yl6 (more details), 2.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form b)
PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1yl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl6a2 d.81.1.3 (A:106-214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat
stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr

SCOPe Domain Coordinates for d1yl6a2 are not available.

Timeline for d1yl6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yl6a1, d1yl6a3
View in 3D
Domains from other chains:
(mouse over for more information)
d1yl6b1, d1yl6b2, d1yl6b3