SCOPe 2.05: Domain d1yl5a2: 1yl5 A:106-214

Lineage for d1yl5a2 (1yl5 A:106-214)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Dihydrodipicolinate reductase [55371] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [103104] (5 PDB entries)

8. Domain d1yl5a2: 1yl5 A:106-214 [123618]
   Other proteins in same PDB: d1yl5a1, d1yl5b1
   automatically matched to d1c3va2
   complexed with mg

Details for d1yl5a2

PDB Entry: 1yl5, 2.3 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a)

PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1yl5a2:

Sequence; same for both SEQRES and ATOM records:

>d1yl5a2 d.81.1.3 (A:106-214) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]}
aigavlsmhfakqaarffdsaevielhhphkadapsgtaartakliaearkglppnpdat
stslpgargadvdgipvhavrlaglvahqevlfgtegetltirhdsldr

Timeline for d1yl5a2:

• d1yl5a2 first appeared in SCOP 1.73
  
• d1yl5a2 appears in SCOPe 2.04
  
• d1yl5a2 appears in SCOPe 2.06
  
• d1yl5a2 appears in the current release, SCOPe 2.08