SCOPe 2.07: Domain d1yl4q1: 1yl4 Q:2-61

Lineage for d1yl4q1 (1yl4 Q:2-61)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d1yl4q1: 1yl4 Q:2-61 [123610]
   Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1

Details for d1yl4q1

PDB Entry: 1yl4, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3

PDB Compounds: (Q:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1yl4q1:

Sequence; same for both SEQRES and ATOM records:

>d1yl4q1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1yl4q1:

• d1yl4q1 first appeared in SCOP 1.73
  
• d1yl4q1 appears in SCOPe 2.06
  
• d1yl4q1 appears in the current release, SCOPe 2.08