Class g: Small proteins [56992] (85 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) |
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
Protein Ribosomal protein S14 [57753] (1 species) |
Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries) |
Domain d1yl4q1: 1yl4 Q:2-61 [123610] Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1 automatically matched to d1fjgn_ |
PDB Entry: 1yl4 (more details), 5.5 Å
SCOP Domain Sequences for d1yl4q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl4q1 g.39.1.7 (Q:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d1yl4q1: