| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
| Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
| Protein Ribosomal protein S11 [53141] (2 species) |
| Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
| Domain d1yl4n1: 1yl4 N:11-129 [123607] Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1 automatically matched to d1i94k_ |
PDB Entry: 1yl4 (more details), 5.5 Å
SCOP Domain Sequences for d1yl4n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl4n1 c.55.4.1 (N:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d1yl4n1: