![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() automatically mapped to Pfam PF00338 |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
![]() | Domain d1yl4m1: 1yl4 M:3-100 [123606] Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1 |
PDB Entry: 1yl4 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl4m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl4m1 d.58.15.1 (M:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1yl4m1: