Lineage for d1yl4k1 (1yl4 K:1-138)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541110Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2541111Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2541112Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2541113Protein Ribosomal protein S8 [56049] (4 species)
  7. 2541131Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2541175Domain d1yl4k1: 1yl4 K:1-138 [123604]
    Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1

Details for d1yl4k1

PDB Entry: 1yl4 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
PDB Compounds: (K:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1yl4k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl4k1 d.140.1.1 (K:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1yl4k1:

Click to download the PDB-style file with coordinates for d1yl4k1.
(The format of our PDB-style files is described here.)

Timeline for d1yl4k1: