Lineage for d1yl4j1 (1yl4 J:2-156)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644314Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 644315Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 644316Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 644317Protein Ribosomal protein S7 [47975] (3 species)
  7. 644322Species Thermus thermophilus [TaxId:274] [47977] (38 PDB entries)
  8. 644356Domain d1yl4j1: 1yl4 J:2-156 [123603]
    Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1
    automatically matched to d1fjgg_

Details for d1yl4j1

PDB Entry: 1yl4 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
PDB Compounds: (J:) 30S ribosomal protein S7

SCOP Domain Sequences for d1yl4j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl4j1 a.75.1.1 (J:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1yl4j1:

Click to download the PDB-style file with coordinates for d1yl4j1.
(The format of our PDB-style files is described here.)

Timeline for d1yl4j1: