| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
| Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
| Protein Ribosomal protein S7 [47975] (4 species) |
| Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
| Domain d1yl4j1: 1yl4 J:2-156 [123603] Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1 |
PDB Entry: 1yl4 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl4j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl4j1 a.75.1.1 (J:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1yl4j1: