Lineage for d1yl4i1 (1yl4 I:1-101)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725083Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 725084Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 725085Protein Ribosomal protein S6 [54997] (2 species)
  7. 725088Species Thermus thermophilus [TaxId:274] [54998] (42 PDB entries)
  8. 725123Domain d1yl4i1: 1yl4 I:1-101 [123602]
    Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1
    automatically matched to d1fjgf_

Details for d1yl4i1

PDB Entry: 1yl4 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
PDB Compounds: (I:) 30S ribosomal protein S6

SCOP Domain Sequences for d1yl4i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl4i1 d.58.14.1 (I:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1yl4i1:

Click to download the PDB-style file with coordinates for d1yl4i1.
(The format of our PDB-style files is described here.)

Timeline for d1yl4i1: