SCOPe 2.07: Domain d1yl4h1: 1yl4 H:74-154

Lineage for d1yl4h1 (1yl4 H:74-154)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d1yl4h1: 1yl4 H:74-154 [123600]
   Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1

Details for d1yl4h1

PDB Entry: 1yl4, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3

PDB Compounds: (H:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1yl4h1:

Sequence; same for both SEQRES and ATOM records:

>d1yl4h1 d.14.1.1 (H:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d1yl4h1:

• d1yl4h1 first appeared in SCOP 1.73
  
• d1yl4h1 appears in SCOPe 2.06
  
• d1yl4h1 appears in the current release, SCOPe 2.08