SCOP 1.73: Domain d1yl4f2: 1yl4 F:107-207

Lineage for d1yl4f2 (1yl4 F:107-207)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)

8. Domain d1yl4f2: 1yl4 F:107-207 [123598]
   Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1
   automatically matched to d1fjgc2

Details for d1yl4f2

PDB Entry: 1yl4, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3

PDB Compounds: (F:) 30S ribosomal protein S3

SCOP Domain Sequences for d1yl4f2:

Sequence; same for both SEQRES and ATOM records:

>d1yl4f2 d.53.1.1 (F:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1yl4f2:

• d1yl4f2 is new in SCOP 1.73
  
• d1yl4f2 appears in SCOP 1.75
  
• d1yl4f2 appears in the current release, SCOPe 2.08