Lineage for d1yl3x1 (1yl3 X:1-60)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655592Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1655593Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1655594Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1655637Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 1655675Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 1655684Domain d1yl3x1: 1yl3 X:1-60 [123595]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1
    automatically matched to d1bxya_

Details for d1yl3x1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (X:) 50S ribosomal protein L30

SCOPe Domain Sequences for d1yl3x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl3x1 d.59.1.1 (X:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d1yl3x1:

Click to download the PDB-style file with coordinates for d1yl3x1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3x1: