Lineage for d1yl3w1 (1yl3 W:1-65)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633322Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 633323Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 633324Protein Ribosomal protein L29 (L29p) [46563] (4 species)
  7. 633325Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
  8. 633366Domain d1yl3w1: 1yl3 W:1-65 [123594]
    Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3x1
    automatically matched to d1ffks_

Details for d1yl3w1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (W:) 50S ribosomal protein L29

SCOP Domain Sequences for d1yl3w1:

Sequence, based on SEQRES records: (download)

>d1yl3w1 a.2.2.1 (W:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records): (download)

>d1yl3w1 a.2.2.1 (W:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

SCOP Domain Coordinates for d1yl3w1:

Click to download the PDB-style file with coordinates for d1yl3w1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3w1: