Lineage for d1yl3u1 (1yl3 U:1-113)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946783Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 946826Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 946866Species Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)
    Uniprot P10972
  8. 946907Domain d1yl3u1: 1yl3 U:1-113 [123593]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3v1, d1yl3w1, d1yl3x1
    automatically matched to d1ffkq_

Details for d1yl3u1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (U:) 50S ribosomal protein L24

SCOPe Domain Sequences for d1yl3u1:

Sequence, based on SEQRES records: (download)

>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Sequence, based on observed residues (ATOM records): (download)

>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

SCOPe Domain Coordinates for d1yl3u1:

Click to download the PDB-style file with coordinates for d1yl3u1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3u1: