| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) ![]() many known members contain KOW motif |
| Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
| Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
| Species Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries) Uniprot P10972 |
| Domain d1yl3u1: 1yl3 U:1-113 [123593] Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3v1, d1yl3w1, d1yl3x1 automatically matched to d1ffkq_ |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl3u1:
Sequence, based on SEQRES records: (download)
>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
Timeline for d1yl3u1:
View in 3DDomains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3v1, d1yl3w1, d1yl3x1 |