Lineage for d1yl3t1 (1yl3 T:1-78)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175862Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2175863Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2175864Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2175865Protein Ribosomal protein L23 [54191] (4 species)
  7. 2175963Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 2175971Domain d1yl3t1: 1yl3 T:1-78 [123592]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3t1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (T:) 50S ribosomal protein L23

SCOPe Domain Sequences for d1yl3t1:

Sequence, based on SEQRES records: (download)

>d1yl3t1 d.12.1.1 (T:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqeva

Sequence, based on observed residues (ATOM records): (download)

>d1yl3t1 d.12.1.1 (T:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
kkavvrlsedddqeva

SCOPe Domain Coordinates for d1yl3t1:

Click to download the PDB-style file with coordinates for d1yl3t1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3t1: