![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (5 species) |
![]() | Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries) |
![]() | Domain d1yl3s1: 1yl3 S:2-110 [123591] Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 automatically matched to d1bxea_ |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl3s1:
Sequence, based on SEQRES records: (download)
>d1yl3s1 d.55.1.1 (S:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
>d1yl3s1 d.55.1.1 (S:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d1yl3s1:
![]() Domains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 |